PDB entry 5fmi

View 5fmi on RCSB PDB site
Description: Human Bak Q77L
Class: apoptosis
Keywords: bak, apoptosis, bcl-2 family
Deposited on 2015-11-06, released 2016-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2 homologous antagonist/killer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16611 (0-161)
      • engineered mutation (54)
      • engineered mutation (143)
    Domains in SCOPe 2.08: d5fmia_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fmiA (A:)
    seeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrllaiig
    ddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlalhv
    yqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaalnlg