PDB entry 5fl4

View 5fl4 on RCSB PDB site
Description: Three dimensional structure of human carbonic anhydrase IX in complex with 5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl)thiophene-2-sulfonamide
Class: lyase
Keywords: lyase
Deposited on 2015-10-21, released 2015-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.06: d5fl4a_
  • Chain 'B':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.06: d5fl4b_
  • Chain 'C':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.06: d5fl4c_
  • Chain 'D':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.06: d5fl4d_
  • Heterogens: ZN, 9FK, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fl4A (A:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fl4A (A:)
    wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
    svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
    rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
    fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
    lngrvieasfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fl4B (B:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fl4B (B:)
    wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
    svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
    rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
    fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
    lngrvieasfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fl4C (C:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fl4C (C:)
    wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
    svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
    rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
    fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
    lngrvieasfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fl4D (D:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fl4D (D:)
    wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
    svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
    rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
    fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
    lngrvieasfp