PDB entry 5fkl

View 5fkl on RCSB PDB site
Description: TetR(D) H100A mutant in complex with anhydrotetracycline and magnesium
Class: transcription
Keywords: transcription, repressor, antibiotic resistance, tetr
Deposited on 2015-10-17, released 2016-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor, class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6G9U5 (1-206)
      • expression tag (0)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5fkla1, d5fkla2, d5fkla3
  • Heterogens: TDC, MG, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fklA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fklA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpenlppllrealqimdsddgeqa
    flhgleslirgfevqltallqiv