PDB entry 5fkk

View 5fkk on RCSB PDB site
Description: TetR(D) N82A mutant in complex with anhydrotetracycline and magnesium
Class: transcription
Keywords: transcription, repressor, antibiotic resistance, tetr
Deposited on 2015-10-17, released 2016-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor, class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6G9U5 (1-206)
      • expression tag (0)
      • engineered mutation (80)
    Domains in SCOPe 2.06: d5fkka1, d5fkka2, d5fkka3
  • Chain 'B':
    Compound: tetracycline repressor, class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6G9U5 (1-206)
      • expression tag (0)
      • engineered mutation (80)
    Domains in SCOPe 2.06: d5fkkb1, d5fkkb2, d5fkkb3
  • Heterogens: PG4, SO4, CL, TDC, MG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fkkA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fkkA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdpdenlppllrealqimdsddgeqa
    flhgleslirgfevqltallqiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fkkB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fkkB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaalppllrealqimdsddgeqaflhgles
    lirgfevqltallqiv