PDB entry 5fka

View 5fka on RCSB PDB site
Description: Crystal structure of staphylococcal enterotoxin E in complex with a T cell receptor
Class: immune system
Keywords: immune system, superantigen, staphylcococcal enterotoxin, t cell receptor, major histocompatibility complex
Deposited on 2015-10-15, released 2016-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FKA
    Domains in SCOPe 2.06: d5fkaa1, d5fkaa2
  • Chain 'B':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FKA
    Domains in SCOPe 2.06: d5fkab1, d5fkab2
  • Chain 'C':
    Compound: staphylococcal enterotoxin e
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5fkac1, d5fkac2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fkaA (A:)
    mgiqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrl
    sattvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlaniqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fkaA (A:)
    giqveqsppdlilqeganstlrcnfsdsvnnlqwfhqngqlinlfyipsgtkqngrlsat
    tvaterysllyisssqttdsgvyfcavdsagtykyifgtgtrlkvlaniqnpdpavyqlr
    dskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacan
    afnnsiipedtffpspe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fkaB (B:)
    mdtgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksr
    llsdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvtedlknvf
    ppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fkaB (B:)
    tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
    sdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvtedlknvfpp
    evavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fkaC (C:)
    sekseeinekdlrkkselqrnalsnlrqiyyynekaitenkesddqflentllfkgfftg
    hpwyndllvdlgskdatnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq
    rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fkaC (C:)
    kdlrkkselqrnalsnlrqiyyynekaitenkesddqflentllfkgfftghpwyndllv
    dlgskdatnkykgkkvdlygayygyqcagnktacmyggvtlhdnnrlteekkvpinlwid
    gkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvqrglivfhssegs
    tvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt