PDB entry 5fjk

View 5fjk on RCSB PDB site
Description: Crystal structure of human JMJD2C catalytic domain in complex 6-ethyl- 5-methyl-7-oxo-4,7-dihydropyrazolo(1,5-a)pyrimidine-3-carbonitrile
Class: oxidoreductase
Keywords: oxidoreductase, transcription regulation, metal binding, demethylase, lysine-specific demethylase 4c,
Deposited on 2015-10-09, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fjka_
  • Heterogens: ZN, NI, EM6, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fjkA (A:)
    gpmnvaevesplnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkpr
    qcyddidnllipapiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyed
    lerkywknltfvapiygadingsiydegvdewniarlntvldvveeecgisiegvntpyl
    yfgmwkttfawhtedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcda
    flrhkmtlispsvlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrw
    idygkvaklctcrkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fjkA (A:)
    lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
    papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
    vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
    htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
    svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
    crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk