PDB entry 5fiv

View 5fiv on RCSB PDB site
Description: structural studies of hiv and fiv proteases complexed with an efficient inhibitor of fiv pr
Deposited on 1998-12-02, released 1998-12-09
The last revision prior to the SCOP 1.61 freeze date was dated 2000-02-03, with a file datestamp of 2000-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1644
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d5fiva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fivA (A:)
    gttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigigggkr
    gtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm