PDB entry 5fhv

View 5fhv on RCSB PDB site
Description: Crystal structure of mCherry after reaction with 2-mercaptoethanol
Class: fluorescent protein
Keywords: Fluorescent protein, 2-mercaptoethanol, Michael addition
Deposited on 2015-12-22, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mCherry-BME
    Species: Discosoma sp. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FHV
    Domains in SCOPe 2.06: d5fhva1, d5fhva2, d5fhva3
  • Heterogens: PGE, BME, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fhvA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaiikefmrfkvhmegsv
    nghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfmygxskayvkhpadipd
    ylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklrgtnfpsdgpvmqkktm
    gweassermypedgalkgeikqrlklkdgghydaevkttykakkpvqlpgaynvnikldi
    tshnedytiveqyeraegrhstggmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhvA (A:)
    dnmaiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdils
    pqfmygxskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiyk
    vklrgtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevktty
    kakkpvqlpgaynvniklditshnedytiveqyeraegrhstgg