PDB entry 5ffy

View 5ffy on RCSB PDB site
Description: Crystal structure of the bromodomain of human BRPF1 in complex with a benzimidazole ligand
Class: transcription
Keywords: Peregrin, MOZ-MORF complex, transcription
Deposited on 2015-12-19, released 2015-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ffya_
  • Heterogens: 5XD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ffyA (A:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ffyA (A:)
    qltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayryl
    nfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm