PDB entry 5fff

View 5fff on RCSB PDB site
Description: Noroxomaritidine/Norcraugsodine Reductase in complex with NADP+ and piperonal
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase alkaloid biosynthesis, OXIDOREDUCTASE
Deposited on 2015-12-18, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Noroxomaritidine/Norcraugsodine Reductase
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FFF (0-256)
    Domains in SCOPe 2.07: d5fffa_
  • Chain 'B':
    Compound: Noroxomaritidine/Norcraugsodine Reductase
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FFF (0-256)
    Domains in SCOPe 2.07: d5fffb_
  • Heterogens: NAP, 5XC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fffA (A:)
    mslekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlky
    dvtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavn
    lesafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewa
    kdnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsas
    yitgqvicvdggrting
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fffB (B:)
    mslekrwslegttalvtggtkgighaiveelvgfgarvytcsrneaelrkclqewenlky
    dvtgsvcdvssrtereklaeevssvfngklnilinnaggyvnkpidgftaedfsflvavn
    lesafhlcqlahpmlkasgtgsivhissccaqiaipghsiysstkgainqltrnlacewa
    kdnirtnsiapgairtpgtesfvidkdaldrevsrvpfgrigepeevaslaaflcmpsas
    yitgqvicvdggrting