PDB entry 5fem

View 5fem on RCSB PDB site
Description: Saccharomyces cerevisiae Acetohydroxyacid Synthase in complex with bensulfuron methyl
Class: transferase
Keywords: Herbicide, sulfonylurea, branched-chain amino acid, acetohydroxyacid synthase, ThDP, FAD, pyruvate, TRANSFERASE
Deposited on 2015-12-17, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase catalytic subunit, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fema1, d5fema2, d5fema3
  • Chain 'B':
    Compound: Acetolactate synthase catalytic subunit, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5femb1, d5femb2, d5femb3
  • Heterogens: MG, FAD, 60G, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5femA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5femA (A:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpstsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraq
    ipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskf
    apearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewf
    aqinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhw
    twrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagt
    pvkililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldak
    lkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5femB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5femB (B:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpstsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraq
    ipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskf
    apearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewf
    aqinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhw
    twrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagt
    pvkililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldak
    lkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh