PDB entry 5fef

View 5fef on RCSB PDB site
Description: Crystal structure of the allergen profilin (Zea m 12)
Class: allergen
Keywords: Actin-binding protein, Allergen, Allergy, Cross-reactivity, Zea m 12
Deposited on 2015-12-16, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin-5
    Species: Zea mays [TaxId:4577]
    Gene: PRO5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FR39 (1-131)
      • expression tag (0)
    Domains in SCOPe 2.06: d5fefa1, d5fefa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fefA (A:)
    gmswqayvddhllcdiegqhlsaaaivghdgsvwaqsenfpelkpeevagmikdfdepgt
    laptglfvggtkymviqgepgvvirgkkgtggitikktgmsliigiydepmtpgqcnmvv
    erlgdylieqgf