PDB entry 5fee

View 5fee on RCSB PDB site
Description: EGFR kinase domain T790M mutant in complex with a covalent aminobenzimidazole inhibitor.
Class: transferase/transferase inhibitor
Keywords: Kinase, Inhibitor, Covalently bound, T790M, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-12-16, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (95)
    Domains in SCOPe 2.07: d5feea_
  • Heterogens: 5X4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5feeA (A:)
    ggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
    ankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyl
    lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
    kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
    qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
    snfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5feeA (A:)
    eapnqallrilketefkkikvlgstvykglwipegekvkipvaikespkankeildeayv
    masvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiakgm
    nyledrrlvhrdlaarnvlvktpqhvkitdfglaklleyhaeggkvpikwmalesilhri
    ythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkc
    wmidadsrpkfreliiefskmardpqrylviqgdemddvvdadeyli