PDB entry 5fed

View 5fed on RCSB PDB site
Description: EGFR kinase domain in complex with a covalent aminobenzimidazole inhibitor.
Class: transferase/transferase inhibitor
Keywords: Kinase, Inhibitor, Covalently-bound, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-12-16, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5feda_
  • Heterogens: 5X4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fedA (A:)
    ggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
    ankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyl
    lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
    kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
    qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
    snfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fedA (A:)
    eapnqallrilketefkkikvlgsgtvykglwipegekvkipvaikespkankeildeay
    vmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakg
    mnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkeyhaeggkvpikwmalesilh
    riythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimv
    kcwmidadsrpkfreliiefskmardpqrylviqgdemddvvdadeyl