PDB entry 5fe1

View 5fe1 on RCSB PDB site
Description: Crystal structure of human PCAF bromodomain in complex with fragment BR004 (fragment 1)
Class: signaling protein
Keywords: SIGNALING PROTEIN, bromodomain, Histone acetyltransferase KAT2B, histone, acetylation, acetyllysine, epigenetics, structural genomics consortium (SGC)
Deposited on 2015-12-16, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT2B, PCAF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fe1a_
  • Chain 'B':
    Compound: Histone acetyltransferase KAT2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT2B, PCAF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fe1b_
  • Heterogens: 12Q, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fe1A (A:)
    smgkekskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlkt
    mserlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fe1A (A:)
    dpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyv
    skklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fe1B (B:)
    smgkekskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlkt
    mserlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fe1B (B:)
    rdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryy
    vskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid