PDB entry 5fds

View 5fds on RCSB PDB site
Description: Crystal structure of the monomeric allergen profilin (Hev b 8)
Class: allergen
Keywords: Actin Binding Protein, Allergen, Allergy, Cross-reactivity, Hev b 8
Deposited on 2015-12-16, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: profilin-2
    Species: Hevea brasiliensis [TaxId:3981]
    Gene: PRO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fdsa_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5fdsA (A:)
mswqayvddhlmceiegnhlsaaaiigqdgsvwaqsanfpqfkseeitgimsdfhepgtl
aptglyiggtkymviqgepgavirgkkgpggvtvkktnqaliigiydepmtpgqcnmive
rlgdylidqgy