PDB entry 5fda

View 5fda on RCSB PDB site
Description: The high resolution structure of apo form dihydrofolate reductase from Yersinia pestis at 1.55 A
Class: oxidoreductase
Keywords: Structural Genomics, Center For Structural Genomics Of Infectious Diseases, CSGID, Dihydrofolate Reductase, Yersinia pestis, OXIDOREDUCTASE
Deposited on 2015-12-15, released 2015-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: folA, AK38_2080
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5fdaa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5fdaA (A:)
snamiisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpg
rlnivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthid
aevggdthfpdyepdewesvfsefhdadeanshsycfeilerr

    Sequence, based on observed residues (ATOM records): (download) 
    >5fdaA (A:)
amiisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrl
nivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidae
vggdthfpdyepdewesvfsefhdadeanshsycfeilerr