PDB entry 5fd1

View 5fd1 on RCSB PDB site
Description: crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6
Class: electron transport(iron-sulfur)
Keywords: electron transport(iron-sulfur)
Deposited on 1993-06-29, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fd1a_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fd1A (A:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler