PDB entry 5fd0

View 5fd0 on RCSB PDB site
Description: Streptomyces plicatus N-acetyl-beta-hexosaminidase in complex with NAGlucal
Class: hydrolase
Keywords: Family 20 glycoside hydrolase, SpHex, GH20, NAG-glucal, hexosaminidase, glycosidase inhibitor, HYDROLASE
Deposited on 2015-12-15, released 2016-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-N-acetylhexosaminidase
    Species: Streptomyces plicatus [TaxId:1922]
    Gene: hex
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fd0a1, d5fd0a2
  • Heterogens: NAG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fd0A (A:)
    mhhhhhhhtgaapdrkapvrptpldrvipapasvdpggapyritrgthirvddsrearrv
    gdyladllrpatgyrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglf
    hgvqtlrqllppavekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryi
    drvarykynklhlhlsddqgwriaidswprlatyggstevgggpggyytkaeykeivrya
    asrhlevvpeidmpghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvdd
    vigelaaltpgrylhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepve
    galvqywgldrtgdaekaevaeaarngtglilspadrtyldmkytkdtplglswagyvev
    qrsydwdpagylpgapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasth
    dwdtykvrlaaqapyweaagidfyrspqvpwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd0A (A:)
    drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
    yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
    vekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryidrvarykynklhl
    hlsddqgwriaidswprlatyggstevgggpggyytkaeykeivryaasrhlevvpeidm
    pghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvddvigelaaltpgry
    lhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepvegalvqywgldrtg
    daekaevaeaarngtglilspadrtyldmkytkdtplglswagyvevqrsydwdpagylp
    gapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasthdwdtykvrlaaqa
    pyweaagidfyrspqvpwt