PDB entry 5fcc

View 5fcc on RCSB PDB site
Description: Structure of HutD from Pseudomonas fluorescens SBW25 (NaCl condition)
Class: unknown function
Keywords: bicupin, histidine degradation, UNKNOWN FUNCTION
Deposited on 2015-12-15, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HutD
    Species: Pseudomonas fluorescens (strain SBW25) [TaxId:216595]
    Gene: PFLU_0360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fcca_
  • Chain 'B':
    Compound: HutD
    Species: Pseudomonas fluorescens (strain SBW25) [TaxId:216595]
    Gene: PFLU_0360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fccb_
  • Heterogens: EDO, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fccA (A:)
    mghhhhhhsaisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggf
    ssfagyqrvitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliy
    speryharlqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisv
    tgrcclieltqrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fccA (A:)
    saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr
    vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar
    lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie
    ltqrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fccB (B:)
    mghhhhhhsaisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggf
    ssfagyqrvitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliy
    speryharlqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisv
    tgrcclieltqrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fccB (B:)
    saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr
    vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar
    lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie
    ltqrg