PDB entry 5fbc

View 5fbc on RCSB PDB site
Description: S1 nuclease from Aspergillus oryzae in complex with 2'-deoxyadenosine-5'-thio-monophosphate (5'dAMP(S)).
Class: hydrolase
Keywords: Endonuclease, Zinc dependent, Complex, hydrolase
Deposited on 2015-12-14, released 2016-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclease S1
    Species: Aspergillus oryzae RIB40 [TaxId:510516]
    Gene: nucS, AO090001000075
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fbca_
  • Heterogens: ZN, NAG, AS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5fbcA (A:)
wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwadtykytdagefskpyh
fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi
hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik
tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks
qpvfeeliakagyrlaawldliasqps