PDB entry 5faz

View 5faz on RCSB PDB site
Description: Crystal structure of the Q108K:K40L:T51V mutant of human Cellular Retinol Binding Protein II in complex with All-trans-Retinal after 24 hours of incubation at 1.4 Angstrom Resolution
Class: transport protein
Keywords: all-trans retinal, retinal light absorbing pigment, wavelength regulation, TRANSPORT PROTEIN
Deposited on 2015-12-13, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-132)
    • engineered mutation (39)
    • engineered mutation (50)
    • engineered mutation (107)
  Domains in SCOPe 2.07: d5faza_
• Chain 'B':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-132)
    • engineered mutation (39)
    • engineered mutation (50)
    • engineered mutation (107)
  Domains in SCOPe 2.07: d5fazb_
• Heterogens: ACT, RET, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5fazA (A:)
  trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkvkttstfrny
  dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
  cgdqvcrqvfkkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5fazB (B:)
  trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkvkttstfrny
  dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
  cgdqvcrqvfkkk