PDB entry 5fau

View 5fau on RCSB PDB site
Description: wild-type choline TMA lyase in complex with choline
Class: lyase
Keywords: radical, lyase, barrel
Deposited on 2015-12-12, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5faua_
  • Chain 'B':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5faub_
  • Chain 'C':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fauc_
  • Chain 'D':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5faud_
  • Heterogens: CHT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fauA (A:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fauA (A:)
    gipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetap
    lviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreev
    fpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmld
    iqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrk
    aelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyrad
    idsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatn
    dltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmml
    akgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpd
    mgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgr
    dvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqil
    adclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllga
    sangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpe
    genglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckd
    vqdeiisrtmlhgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fauB (B:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fauB (B:)
    sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
    plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
    vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
    diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
    kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
    didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
    ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
    lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
    dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
    rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
    ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
    asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
    egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
    dvqdeiisrtmlhgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fauC (C:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fauC (C:)
    sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
    plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
    vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
    diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
    kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
    didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
    ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
    lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
    dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
    rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
    ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
    asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
    egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
    dvqdeiisrtmlhgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fauD (D:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fauD (D:)
    sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
    plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
    vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
    diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
    kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
    didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
    ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
    lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
    dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
    rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
    ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
    asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
    egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
    dvqdeiisrtmlhgf