PDB entry 5faf
View 5faf on RCSB PDB site
Description: N184K pathological variant of gelsolin domain 2 (orthorhombic form)
Class: structural protein
Keywords: amyloidosis, calcium, mutation, actin, structural protein
Deposited on
2015-12-11, released
2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated
2016-10-05, with a file datestamp of
2016-09-30.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: gelsolin
Species: Homo sapiens [TaxId:9606]
Gene: GSN
Database cross-references and differences (RAF-indexed):
- Uniprot P06396 (3-End)
- expression tag (0-2)
- engineered mutation (36)
Domains in SCOPe 2.07: d5fafa1, d5fafa2 - Heterogens: CA, GOL, CL, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5fafA (A:)
gshhvvpnevvvqrlfqvkgrrvvratevpvswesfkngdcfildlgnnihqwcgsnsnr
yerlkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedtakedaa
Sequence, based on observed residues (ATOM records): (download)
>5fafA (A:)
gshhvvpnevvvqrlfqvkgrrvvratevpvswesfkngdcfildlgnnihqwcgsnsnr
yerlkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedt