PDB entry 5faf

View 5faf on RCSB PDB site
Description: N184K pathological variant of gelsolin domain 2 (orthorhombic form)
Class: structural protein
Keywords: amyloidosis, calcium, mutation, actin, structural protein
Deposited on 2015-12-11, released 2016-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Gene: GSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06396 (3-End)
      • expression tag (0-2)
      • engineered mutation (36)
    Domains in SCOPe 2.06: d5fafa1, d5fafa2
  • Heterogens: CA, GOL, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5fafA (A:)
gshhvvpnevvvqrlfqvkgrrvvratevpvswesfkngdcfildlgnnihqwcgsnsnr
yerlkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedtakedaa

    Sequence, based on observed residues (ATOM records): (download) 
    >5fafA (A:)
gshhvvpnevvvqrlfqvkgrrvvratevpvswesfkngdcfildlgnnihqwcgsnsnr
yerlkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedt