PDB entry 5f9t

View 5f9t on RCSB PDB site
Description: Crystal Structure of Streptococcus pneumoniae NanC, covalent complex with a fluorinated Neu5Ac derivative
Class: hydrolase
Keywords: Sialidase, Neuraminidase, covalent intermediate, CBM40, hydrolase
Deposited on 2015-12-10, released 2015-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase C
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanC, ERS070194_01339
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5f9ta1, d5f9ta2, d5f9ta3
  • Chain 'B':
    Compound: Neuraminidase C
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: nanC, ERS070194_01339
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5f9tb1, d5f9tb2, d5f9tb3
  • Heterogens: FSI, SFJ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f9tA (A:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f9tB (B:)
    etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
    nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
    lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
    tvkkmttnavtghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkini
    atsysddngktwtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkq
    vlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnr
    ptefsvdknfgikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptny
    iayissndhgeswsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiy
    sddngaswkvkvvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsape
    ylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwry
    hhdvdysnygysystltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkknl