PDB entry 5f9b

View 5f9b on RCSB PDB site
Description: X-ray crystal structure of PPARgamma in the complex with caulophyllogenin
Class: transcription
Keywords: nuclear receptor, transcription factor, diabetes, bundle of alpha-helices, transcription
Deposited on 2015-12-09, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f9ba_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f9bb_
  • Heterogens: 5VN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f9bA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9bA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkivair
    ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
    isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
    lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
    tdmslhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f9bB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9bB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgkevairif
    qgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlis
    egqgfmtreflkslkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
    kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdm
    slhpllqeiy