PDB entry 5f9a

View 5f9a on RCSB PDB site
Description: Blood group antigen binding adhesin BabA of Helicobacter pylori strain P436 in complex with blood group H Lewis b hexasaccharide
Class: cell adhesion
Keywords: Adhesin, Lectin, Nanobody, Complex, Cell Adhesion
Deposited on 2015-12-09, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adhesin binding fucosylated histo-blood group antigen,Adhesin,Adhesin binding fucosylated histo-blood group antigen
    Species: Helicobacter pylori [TaxId:210]
    Gene: babA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52269 (Start-177)
    • Uniprot Q6DT10 (178-247)
    • Uniprot O52269 (248-454)
      • expression tag (455-457)
  • Chain 'C':
    Compound: Nanobody Nb-ER19
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5F9A
    Domains in SCOPe 2.07: d5f9ac1, d5f9ac2
  • Heterogens: GLC, GAL, NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5f9aC (C:)
    qvqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnya
    dsvkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9aC (C:)
    vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
    svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvss