PDB entry 5f9a
View 5f9a on RCSB PDB site
Description: Blood group antigen binding adhesin BabA of Helicobacter pylori strain P436 in complex with blood group H Lewis b hexasaccharide
Class: cell adhesion
Keywords: Adhesin, Lectin, Nanobody, Complex, Cell Adhesion
Deposited on
2015-12-09, released
2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated
2016-01-27, with a file datestamp of
2016-01-22.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Adhesin binding fucosylated histo-blood group antigen,Adhesin,Adhesin binding fucosylated histo-blood group antigen
Species: Helicobacter pylori [TaxId:210]
Gene: babA2
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Nanobody Nb-ER19
Species: LAMA GLAMA [TaxId:9844]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5f9ac1, d5f9ac2 - Heterogens: GLC, GAL, NAG, FUC, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>5f9aC (C:)
qvqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnya
dsvkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvsshhhhhh
Sequence, based on observed residues (ATOM records): (download)
>5f9aC (C:)
vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvss