PDB entry 5f99

View 5f99 on RCSB PDB site
Description: X-ray Structure of the MMTV-A Nucleosome Core Particle
Class: DNA binding protein
Keywords: nucleosome core particle histone DNA, DNA binding protein
Deposited on 2015-12-09, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
      • conflict (109)
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f99b_
  • Chain 'C':
    Compound: Histone H2A type 1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897
      • conflict (98)
    Domains in SCOPe 2.07: d5f99c_
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-121)
      • conflict (28)
    Domains in SCOPe 2.07: d5f99d_
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
      • conflict (109)
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62799 (Start-102)
      • engineered mutation (18)
    Domains in SCOPe 2.07: d5f99f_
  • Chain 'G':
    Compound: Histone H2A type 1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897 (Start-128)
      • conflict (98)
      • conflict (122)
    Domains in SCOPe 2.07: d5f99g_
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-121)
      • conflict (28)
    Domains in SCOPe 2.07: d5f99h_
  • Chain 'I':
    Compound: DNA (147-mer)
    Species: Mouse mammary tumor virus [TaxId:11757]
  • Chain 'J':
    Compound: DNA (147-mer)
    Species: Mouse mammary tumor virus [TaxId:11757]
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f99B (B:)
    msgrgkggkglgkggakrrrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f99B (B:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5f99C (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f99C (C:)
    rakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaa
    rdnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5f99D (D:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f99D (D:)
    gkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynk
    rstitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5f99F (F:)
    msgrgkggkglgkggakrrrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f99F (F:)
    gkggakrrrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdav
    tytehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5f99G (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f99G (G:)
    ktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagn
    aardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkktessksaks
    k
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5f99H (H:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f99H (H:)
    rrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrst
    itsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.