PDB entry 5f8v

View 5f8v on RCSB PDB site
Description: Crystal structure of PLP bound phosphoserine aminotransferase (PSAT) from Trichomonas vaginalis
Class: transferase
Keywords: Alpha-family, Aminotransferase, Alpha-beta domains, TRANSFERASE
Deposited on 2015-12-09, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8va_
  • Chain 'B':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8vb_
  • Chain 'C':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8vc_
  • Chain 'D':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8vd_
  • Chain 'E':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8ve_
  • Chain 'F':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8vf_
  • Chain 'G':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8vg_
  • Chain 'H':
    Compound: Aminotransferase, class V family protein
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_224040
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f8vh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f8vA (A:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vA (A:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
    mkewpgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f8vB (B:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vB (B:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
    mkewpgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5f8vC (C:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vC (C:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
    mke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5f8vD (D:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vD (D:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
    mkewpgf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5f8vE (E:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vE (E:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
    mkew
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5f8vF (F:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vF (F:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpctqrklltlkghvfrascynacpmeavdalvqamkew
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5f8vG (G:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vG (G:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
    mkewpgf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5f8vH (H:)
    msaqraynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlr
    tllqvpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgv
    tvnsvagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmss
    nflsrpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknn
    cmyntpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewr
    srmnmpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavda
    lvqamkewpgflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8vH (H:)
    raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
    vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
    vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
    rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
    tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
    mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
    mkewpg