PDB entry 5f7w
View 5f7w on RCSB PDB site
Description: Blood group antigen binding adhesin BabA of Helicobacter pylori strain 17875 in complex with blood group B Lewis b heptasaccharide
Class: cell adhesion
Keywords: Adhesin, Lectin, Nanobody, Complex, Cell Adhesion
Deposited on
2015-12-08, released
2016-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated
2016-01-27, with a file datestamp of
2016-01-22.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Adhesin binding fucosylated histo-blood group antigen
Species: Helicobacter pylori [TaxId:210]
Gene: babA2
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Adhesin binding fucosylated histo-blood group antigen
Species: Helicobacter pylori [TaxId:210]
Gene: babA2
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Nanobody Nb-ER19
Species: LAMA GLAMA [TaxId:9844]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5f7wc1, d5f7wc2 - Chain 'D':
Compound: Nanobody Nb-ER19
Species: LAMA GLAMA [TaxId:9844]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5f7wd1, d5f7wd2 - Heterogens: BGC, GAL, NAG, GLA, FUC, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>5f7wC (C:)
qvqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnya
dsvkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvsshhhhhh
Sequence, based on observed residues (ATOM records): (download)
>5f7wC (C:)
vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvss
- Chain 'D':
Sequence, based on SEQRES records: (download)
>5f7wD (D:)
qvqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnya
dsvkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvsshhhhhh
Sequence, based on observed residues (ATOM records): (download)
>5f7wD (D:)
vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvssh