PDB entry 5f7l

View 5f7l on RCSB PDB site
Description: Blood group antigen binding adhesin BabA of Helicobacter pylori strain 17875 in complex with Nanobody Nb-ER14
Class: cell adhesion
Keywords: Adhesin, Lectin, Nanobody, Complex, Cell Adhesion
Deposited on 2015-12-08, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adhesin binding fucosylated histo-blood group antigen
    Species: Helicobacter pylori [TaxId:210]
    Gene: babA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nanobody Nb-ER14
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5F7L (0-End)
    Domains in SCOPe 2.07: d5f7lb1, d5f7lb2
  • Chain 'C':
    Compound: Adhesin binding fucosylated histo-blood group antigen
    Species: Helicobacter pylori [TaxId:210]
    Gene: babA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nanobody Nb-ER14
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5F7L (0-End)
    Domains in SCOPe 2.07: d5f7ld1, d5f7ld2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f7lB (B:)
    qvqlqesggglvqpggslrlscaasgsiysliamgwyrqapgkehelvatissgsttyya
    dsvkgrftisrdnakntlylqmnslkpedtamyycaaysdrltdcsnceadywgqgtqvt
    vshhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f7lB (B:)
    qvqlqesggglvqpggslrlscaasgsiysliamgwyrqapgkehelvatissgsttyya
    dsvkgrftisrdnakntlylqmnslkpedtamyycaaysdrltdcsnceadywgqgtqvt
    v
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5f7lD (D:)
    qvqlqesggglvqpggslrlscaasgsiysliamgwyrqapgkehelvatissgsttyya
    dsvkgrftisrdnakntlylqmnslkpedtamyycaaysdrltdcsnceadywgqgtqvt
    vshhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f7lD (D:)
    qvqlqesggglvqpggslrlscaasgsiysliamgwyrqapgkehelvatissgsttyya
    dsvkgrftisrdnakntlylqmnslkpedtamyycaaysdrltdcsnceadywgqgtqvt
    vshh