PDB entry 5f6r

View 5f6r on RCSB PDB site
Description: Co-crystal Structure of 3-hydroxydecanoyl-(acyl carrier protein) Dehydratase from Yersinia pestis with 5-Benzoylpentanoic Acid
Class: lyase
Keywords: Lyase, alpha-beta fold, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2015-12-06, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f6ra1, d5f6ra2
  • Chain 'B':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: fabA, AK38_1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f6rb1, d5f6rb2
  • Heterogens: 5VO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f6rA (A:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f6rA (A:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f6rB (B:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f6rB (B:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdt