PDB entry 5f6m

View 5f6m on RCSB PDB site
Description: Isotropic Trypsin Model for Comparison of Diffuse Scattering
Class: hydrolase
Keywords: serine protease, hydrolase
Deposited on 2015-12-06, released 2016-01-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-06, with a file datestamp of 2015-12-31.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5f6ma_
  • Heterogens: CA, BEN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f6mA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn