PDB entry 5f6f

View 5f6f on RCSB PDB site
Description: S. aureus MepR G34R Mutant
Class: transcription regulator
Keywords: Winged helix-turn-helix, DNA binding protein, transcription regulation, multidrug resistance, transcription regulator
Deposited on 2015-12-05, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (23-160)
      • expression tag (20-22)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5f6fa1, d5f6fa2
  • Chain 'B':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (23-160)
      • expression tag (20-22)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5f6fb1, d5f6fb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f6fA (A:)
    mhhhhhhssgvdlgtenlyfqsneftysylfrmishemkqkadqkleqfditneqrhtlg
    ylyahqqdgltqndiakalqrtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgi
    klveaftsifdemeqtlvsqlseeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f6fA (A:)
    qsneftysylfrmishemkqkadqkleqfditneqrhtlgylyahqqdgltqndiakalq
    rtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsq
    lseeeneqmkanltkmlsslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f6fB (B:)
    mhhhhhhssgvdlgtenlyfqsneftysylfrmishemkqkadqkleqfditneqrhtlg
    ylyahqqdgltqndiakalqrtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgi
    klveaftsifdemeqtlvsqlseeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f6fB (B:)
    qsneftysylfrmishemkqkadqkleqfditneqrhtlgylyahqqdgltqndiakalq
    rtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsq
    lseeeneqmkanltkmlsslq