PDB entry 5f5s

View 5f5s on RCSB PDB site
Description: Crystal structure of the Prp38-MFAP1 complex of Homo sapiens
Class: splicing
Keywords: B-specific protein, pre-mRNA splicing, SAH, splicing
Deposited on 2015-12-04, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor 38A
    Species: Homo sapiens [TaxId:9606]
    Gene: PRPF38A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NAV1 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5f5sa1, d5f5sa2
  • Chain 'B':
    Compound: Microfibrillar-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MFAP1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f5sA (A:)
    gamanrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvg
    gvyggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcyk
    yleplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeqle
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f5sA (A:)
    amanrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvgg
    vyggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcyky
    leplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeq
    

  • Chain 'B':
    No sequence available.