PDB entry 5f5c

View 5f5c on RCSB PDB site
Description: Crystal Structure of human JMJD2D complexed with KDOPP7
Class: oxidoreductase
Keywords: DOUBLE-STRANDED BETA HELIX, DEMETHYLASE, OXYGENASE, OXIDOREDUCTASE, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2015-12-04, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4D, JHDM3D, JMJD2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f5ca_
  • Heterogens: ZN, NI, EDO, SO4, 5V3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f5cA (A:)
    yfqsmetmkskancaqnpncnimifhptkeefndfdkyiaymesqgahraglakiippke
    wkaretydniseiliatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphq
    nfedlerkywknriynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvn
    tpylyfgmwkttfawhtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssr
    gcgaflrhkvalisptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfa
    tprwidygkmasqcscgearvtfsmdafvrilqperydlwkrgqdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f5cA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgq