PDB entry 5f4x

View 5f4x on RCSB PDB site
Description: Fructose-1,6-bisphosphate aldolase K229M mutant from rabbit muscle
Class: lyase
Keywords: Aldolase, Class I, Lysine mutant, LYASE
Deposited on 2015-12-03, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d5f4xa_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d5f4xb_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d5f4xc_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d5f4xd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f4xA (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllmpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f4xB (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllmpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f4xC (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllmpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f4xD (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllmpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay