PDB entry 5f4c

View 5f4c on RCSB PDB site
Description: Crystal Structure of Ribonuclease Inhibitor Barstar from Salmonella Typhimurium
Class: hydrolase inhibitor
Keywords: alpha beta protein, Barstar realted, Ribonuclease Inhibitor, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, HYDROLASE INHIBITOR
Deposited on 2015-12-03, released 2015-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: yhcO, STM3363
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5f4ca_
  • Chain 'B':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: yhcO, STM3363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CPM9 (3-92)
      • expression tag (2)
    Domains in SCOPe 2.08: d5f4cb1, d5f4cb2
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5f4cA (A:)
snamnvytfdfndiknqsdfyreftqtfglasekvsdldtlwdavmsdilplpleiefvh
lpdklrrrygalillfdeaeeelegrlrfnvrh

    Sequence, based on observed residues (ATOM records): (download) 
    >5f4cA (A:)
mnvytfdfndiknqsdfyreftqtfglasekvsdldtlwdavmsdilplpleiefvhlpd
klrrrygalillfdeaeeelegrlrfnvrh

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5f4cB (B:)
snamnvytfdfndiknqsdfyreftqtfglasekvsdldtlwdavmsdilplpleiefvh
lpdklrrrygalillfdeaeeelegrlrfnvrh

    Sequence, based on observed residues (ATOM records): (download) 
    >5f4cB (B:)
amnvytfdfndiknqsdfyreftqtfglasekvsdldtlwdavmsdilplpleiefvhlp
dklrrrygalillfdeaeeelegrlrfnvrh