PDB entry 5f2f

View 5f2f on RCSB PDB site
Description: Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to FimH lectin domain
Class: sugar binding protein
Keywords: lectin, mannoside, immunoglobulin fold, carbohydrate binding protein, SUGAR BINDING PROTEIN
Deposited on 2015-12-01, released 2016-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein fimh
  Species: Escherichia coli J96 [TaxId:1206108]
  Gene: fimH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08191 (0-157)
  Domains in SCOPe 2.06: d5f2fa_
• Heterogens: 5U7, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5f2fA (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt