PDB entry 5f2f

View 5f2f on RCSB PDB site
Description: Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to FimH lectin domain
Class: sugar binding protein
Keywords: lectin, mannoside, immunoglobulin fold, carbohydrate binding protein, SUGAR BINDING PROTEIN
Deposited on 2015-12-01, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fimh
    Species: Escherichia coli J96 [TaxId:1206108]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2fa_
  • Heterogens: 5U7, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5f2fA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt