PDB entry 5f2b

View 5f2b on RCSB PDB site
Description: Expanding Nature's Catalytic Repertoire -Directed Evolution of an Artificial Metalloenzyme for In Vivo Metathesis
Class: biotin-binding protein
Keywords: biotin-binding protein, beta barrel, metathesis, organometallic complex
Deposited on 2015-12-01, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (12)
      • engineered mutation (46)
      • engineered mutation (48)
      • engineered mutation (113)
      • engineered mutation (118)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d5f2ba1, d5f2ba2
  • Heterogens: 9RU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f2bA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesaagkaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgqteangw
    rstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2bA (A:)
    deagitgtwynqlgstfivtagadgaltgtyesaagkaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgqteangwrstlvghdtftk
    vk