PDB entry 5ezt

View 5ezt on RCSB PDB site
Description: Peracetylated Bovine Carbonic Anhydrase II
Class: transferase
Keywords: Carbonic Anhydrase, Peracetylated, TRANSFERASE
Deposited on 2015-11-26, released 2016-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Gene: CA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5eztx_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eztX (X:)
hwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvnng
hsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
ntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgsl
lpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellmlan
wrpaqplknrqvrgfpk