PDB entry 5ez5

View 5ez5 on RCSB PDB site
Description: Crystal structure of active Rab11A (S20V) in complex with GTP
Class: transport protein
Keywords: small g protein, p-loop, ras, TRANSPORT PROTEIN
Deposited on 2015-11-26, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (0-167)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d5ez5a_
  • Chain 'B':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (0-167)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d5ez5b_
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ez5A (A:)
ydylfkvvligdvgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ez5B (B:)
ydylfkvvligdvgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri