PDB entry 5eys

View 5eys on RCSB PDB site
Description: Crystal structure of murine neuroglobin mutant F106W at ambient pressure
Class: transport protein
Keywords: globin, oxygen storage-transporter, transport protein
Deposited on 2015-11-25, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (0-147)
      • engineered mutation (52)
      • engineered mutation (103)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d5eysa_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5eysA (A:)
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlsswstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg