PDB entry 5eyk

View 5eyk on RCSB PDB site
Description: crystal structure of aurora b in complex with bi 847325
Class: transferase
Keywords: KINASE, Inhibitor, transferase
Deposited on 2015-11-25, released 2016-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aurora kinase b-a
    Species: Xenopus laevis [TaxId:8355]
    Gene: aurkb-a, airk2-a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DE08
      • engineered mutation (15)
    Domains in SCOPe 2.06: d5eyka_
  • Chain 'B':
    Compound: aurora kinase b-a
    Species: Xenopus laevis [TaxId:8355]
    Gene: aurkb-a, airk2-a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DE08 (0-275)
      • engineered mutation (15)
    Domains in SCOPe 2.06: d5eykb_
  • Chain 'C':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Gene: incenp-a
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Gene: incenp-a
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 5U5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eykA (A:)
    aempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrr
    eieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeel
    adalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppem
    iegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdli
    skllryhppqrlplkgvmehpwvkansrrvlppvyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eykA (A:)
    ftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqsh
    lrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhyc
    herkvihrdikpenllmgykgelkiadfgwsvharrtmcgtldylppemiegkthdekvd
    lwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllryhppqr
    lplkgvmehpwvkansrrvlppvy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eykB (B:)
    aempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrr
    eieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeel
    adalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppem
    iegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdli
    skllryhppqrlplkgvmehpwvkansrrvlppvyq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.