PDB entry 5eyd

View 5eyd on RCSB PDB site
Description: Crystal structure of c-Met in complex with AMG 337
Class: transferase/transferase inhibitor
Keywords: phosphotransferase, inhibitor, cancer, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-11-24, released 2016-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5eyda_
  • Heterogens: 5T1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eydA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eydA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlkihcavkslnritd
    igevsqfltegiimkdfshpnvlsllgiclrssplvvlpymkhgdlrnfirnethnptvk
    dligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhn
    ktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqg
    rrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh