PDB entry 5exb

View 5exb on RCSB PDB site
Description: Wild type green fluorescent protein DendFP (Dendronephthya sp.)
Class: fluorescent protein
Keywords: Fluorescent protein, Photoswitchable fluorescent proteins, chromophore, beta-barrel, biomarker
Deposited on 2015-11-23, released 2016-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exba_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
      • expression tag (224-227)
    Domains in SCOPe 2.06: d5exbb1, d5exbb2
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
      • expression tag (224-226)
    Domains in SCOPe 2.06: d5exbc1, d5exbc2
  • Chain 'D':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
      • expression tag (224)
    Domains in SCOPe 2.06: d5exbd1, d5exbd2
  • Chain 'E':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbe_
  • Chain 'F':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (2-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbf_
  • Chain 'G':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
      • expression tag (224-227)
    Domains in SCOPe 2.06: d5exbg1, d5exbg2
  • Chain 'H':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbh_
  • Chain 'I':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbi_
  • Chain 'J':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (2-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbj_
  • Chain 'K':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (2-223)
      • chromophore (62)
      • expression tag (224-228)
    Domains in SCOPe 2.06: d5exbk1, d5exbk2
  • Chain 'L':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
      • expression tag (224-228)
    Domains in SCOPe 2.06: d5exbl1, d5exbl2
  • Chain 'M':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbm_
  • Chain 'N':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (Start-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbn_
  • Chain 'O':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (2-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbo_
  • Chain 'P':
    Compound: Green fluorescent protein
    Species: Dendronephthya sp. [TaxId:51110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6U0 (2-223)
      • chromophore (62)
    Domains in SCOPe 2.06: d5exbp_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5exbA (A:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbA (A:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5exbB (B:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbB (B:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5exbC (C:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbC (C:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgsh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5exbD (D:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbD (D:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5exbE (E:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbE (E:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5exbF (F:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbF (F:)
    nlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttal
    xnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngm
    nfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvv
    qlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5exbG (G:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbG (G:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5exbH (H:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbH (H:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5exbI (I:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbI (I:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5exbJ (J:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbJ (J:)
    nlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttal
    xnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngm
    nfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvv
    qlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5exbK (K:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbK (K:)
    nlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttal
    xnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngm
    nfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvv
    qlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5exbL (L:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbL (L:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5exbM (M:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbM (M:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5exbN (N:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbN (N:)
    likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
    nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
    fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
    lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5exbO (O:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbO (O:)
    nlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttal
    xnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngm
    nfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvv
    qlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5exbP (P:)
    mgnlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydiltt
    alxnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfn
    gmnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
    vvqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqawgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exbP (P:)
    nlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttal
    xnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngm
    nfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvv
    qlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw