PDB entry 5ews

View 5ews on RCSB PDB site
Description: Sugar binding protein - human galectin-2
Class: sugar binding protein
Keywords: lactose, galectin, SUGAR BINDING PROTEIN
Deposited on 2015-11-21, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsa_
  • Chain 'B':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsb_
  • Chain 'C':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsc_
  • Chain 'D':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsd_
  • Chain 'E':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewse_
  • Chain 'F':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsf_
  • Chain 'G':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsg_
  • Chain 'H':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsh_
  • Chain 'I':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsi_
  • Chain 'J':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsj_
  • Chain 'K':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsk_
  • Chain 'L':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsl_
  • Chain 'M':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsm_
  • Chain 'N':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsn_
  • Chain 'O':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewso_
  • Chain 'P':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ewsp_
  • Heterogens: GAL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ewsA (A:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsA (A:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ewsB (B:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsB (B:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ewsC (C:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsC (C:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ewsD (D:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsD (D:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ewsE (E:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsE (E:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ewsF (F:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsF (F:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ewsG (G:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsG (G:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ewsH (H:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsH (H:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ewsI (I:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsI (I:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5ewsJ (J:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsJ (J:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ewsK (K:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsK (K:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ewsL (L:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsL (L:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5ewsM (M:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsM (M:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5ewsN (N:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsN (N:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5ewsO (O:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsO (O:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5ewsP (P:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ewsP (P:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk