PDB entry 5ew9

View 5ew9 on RCSB PDB site
Description: Crystal Structure of Aurora A Kinase Domain Bound to MK-5108
Class: transferase/transferase inhibitor
Keywords: Transferase, Protein Kinase, Inhibitor, Transferase-Transferase Inhibitor Complex
Deposited on 2015-11-20, released 2016-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ew9a_
  • Heterogens: 5VC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ew9A (A:)
    gpgskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyite
    lanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardl
    isrllkhnpsqrpmlrevlehpwitansskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ew9A (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhrttlcgtldylppemiegrmhdekvd
    lwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqr
    pmlrevlehpwitansskp